PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676788994
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family HB-other
Protein Properties Length: 162aa    MW: 18912.3 Da    PI: 9.4193
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676788994genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.6e-202782156
               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               +++ ++++++q+++Le++F+++++p++ +r+ L ++l+Lt +q+k+WFqN+R++ k
  676788994 27 KKTYQRHSNHQIQRLEAYFKECPHPDEVQRRNLGEELKLTPKQIKFWFQNKRTQAK 82
               78999************************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.25E-18684IPR009057Homeodomain-like
PROSITE profilePS5007116.2932484IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-192590IPR009057Homeodomain-like
SMARTSM003896.6E-182688IPR001356Homeobox domain
CDDcd000863.34E-152785No hitNo description
PfamPF000462.9E-172782IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MDSSRDSSSS DERETSMNTS DGVQGDKKTY QRHSNHQIQR LEAYFKECPH PDEVQRRNLG  60
EELKLTPKQI KFWFQNKRTQ AKAQSEKADN ASLRAENMKI RRENEAMQEA LRTVTCPPCG  120
GPRPGKEERK LYLHNLRAHN ACLKAQINMI YILYLYIRSI EN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590801.13e-74PREDICTED: homeobox-leucine zipper protein HDG9-like
RefseqXP_013679665.14e-76PREDICTED: homeobox-leucine zipper protein HDG9-like
SwissprotQ9FFI02e-61HDG9_ARATH; Homeobox-leucine zipper protein HDG9
TrEMBLA0A0D3CTZ14e-74A0A0D3CTZ1_BRAOL; Uncharacterized protein
STRINGBra003213.1-P7e-70(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17320.16e-56homeodomain GLABROUS 9